Lineage for d5g55a2 (5g55 A:355-524)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045351Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2045369Domain d5g55a2: 5g55 A:355-524 [320398]
    Other proteins in same PDB: d5g55a1, d5g55a3, d5g55a4
    automated match to d1he8a2
    complexed with 3qh, so4

Details for d5g55a2

PDB Entry: 5g55 (more details), 2.45 Å

PDB Description: 3-quinoline carboxamides inhibitors of pi3k
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5g55a2:

Sequence, based on SEQRES records: (download)

>d5g55a2 b.7.1.0 (A:355-524) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwl
efsikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfl
lrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc

Sequence, based on observed residues (ATOM records): (download)

>d5g55a2 b.7.1.0 (A:355-524) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwl
efsikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadklts
atnpdkensmsisilldnyc

SCOPe Domain Coordinates for d5g55a2:

Click to download the PDB-style file with coordinates for d5g55a2.
(The format of our PDB-style files is described here.)

Timeline for d5g55a2: