SCOPe 2.08: Domain d5b7ca1: 5b7c A:2-76

Lineage for d5b7ca1 (5b7c A:2-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Octopus vulgaris [TaxId:6645] [320349] (1 PDB entry)

8. Domain d5b7ca1: 5b7c A:2-76 [320350]
   Other proteins in same PDB: d5b7ca2
   automated match to d1pd212
   complexed with gsh, so4; mutant

Details for d5b7ca1

PDB Entry: 5b7c, 2.35 Å

PDB Description: crystal structure of octopus s-crystallin q108f mutant in complex with glutathione

PDB Compounds: (A:) S-crystallin OctvuS4

SCOPe Domain Sequences for d5b7ca1:

Sequence; same for both SEQRES and ATOM records:

>d5b7ca1 c.47.1.0 (A:2-76) automated matches {Octopus vulgaris [TaxId: 6645]}
psytlhyfnhrgraeicrmlfaaagvqyndrriessewdsmrnkmpchmmpmleldnrtq
ipqsmamarylaref

Timeline for d5b7ca1:

• d5b7ca1 first appeared in SCOPe 2.06
  
• d5b7ca1 appears in SCOPe 2.07