Lineage for d1qg2a_ (1qg2 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Ran [52609] (2 species) Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries) 
Domain d1qg2a_: 1qg2 A: [32034]
Details for d1qg2a_
PDB Entry: 1qg2 (more details), 2.5 Å
PDB Description: canine gdp-ran r76e mutant
SCOP Domain Sequences for d1qg2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qg2a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfggledgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtta
SCOP Domain Coordinates for d1qg2a_:
Click to download the PDB-style file with coordinates for d1qg2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qg2a_:
- d1qg2a_ appears in SCOP 1.57
- d1qg2a_ appears in the current release, SCOPe 2.08
View in 3D