Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries) |
Domain d5g43a1: 5g43 A:265-507 [320333] Other proteins in same PDB: d5g43a2, d5g43a3 automated match to d3l0la_ protein/DNA complex; complexed with 5im |
PDB Entry: 5g43 (more details), 2.58 Å
SCOPe Domain Sequences for d5g43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g43a1 a.123.1.0 (A:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke lfs
Timeline for d5g43a1: