Lineage for d5cxsa1 (5cxs A:14-287)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2888878Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (46 PDB entries)
  8. 2888924Domain d5cxsa1: 5cxs A:14-287 [320326]
    Other proteins in same PDB: d5cxsa2
    automated match to d1tcvb_
    complexed with mes

Details for d5cxsa1

PDB Entry: 5cxs (more details), 1.75 Å

PDB Description: crystal structure of isoform 2 of purine nucleoside phosphorylase complexed with mes
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d5cxsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cxsa1 c.56.2.0 (A:14-287) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
maadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttvaghvgnlvlg
svggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginrklksgdfvl
ikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqendfqdlvhegv
yafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavsliannsildaen
dvsinhekvlavaekradllqmwfkeiitrlpld

SCOPe Domain Coordinates for d5cxsa1:

Click to download the PDB-style file with coordinates for d5cxsa1.
(The format of our PDB-style files is described here.)

Timeline for d5cxsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cxsa2