SCOPe 2.06: Domain d5b12c_: 5b12 C:

Lineage for d5b12c_ (5b12 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Corynebacterium sp. [TaxId:1720] [279066] (4 PDB entries)

8. Domain d5b12c_: 5b12 C: [320315]
   automated match to d4zd6a_
   complexed with cl; mutant

Details for d5b12c_

PDB Entry: 5b12, 1.72 Å

PDB Description: crystal structure of the b-type halohydrin hydrogen-halide-lyase mutant f71w/q125t/d199h from corynebacterium sp. n-1074

PDB Compounds: (C:) Halohydrin epoxidase B

SCOPe Domain Sequences for d5b12c_:

Sequence; same for both SEQRES and ATOM records:

>d5b12c_ c.2.1.0 (C:) automated matches {Corynebacterium sp. [TaxId: 1720]}
grlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlva
nfavdahwgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaamr
ytegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefked
marrvplgrlatarehallalflasdesdfivgksiefdggwat

Timeline for d5b12c_:

• d5b12c_ is new in SCOPe 2.06-stable
  
• d5b12c_ appears in SCOPe 2.07
  
• d5b12c_ appears in the current release, SCOPe 2.08