SCOPe 2.08: Domain d5ctjb_: 5ctj B:

Lineage for d5ctjb_ (5ctj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
   automatically mapped to Pfam PF00731

6. Protein automated matches [191111] (4 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)

8. Domain d5ctjb_: 5ctj B: [320300]
   automated match to d4ycbb_
   complexed with cl, edo, pg0, so4; mutant

Details for d5ctjb_

PDB Entry: 5ctj, 1.93 Å

PDB Description: structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan

PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d5ctjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ctjb_ c.23.8.1 (B:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletfralqtasvpnspite

Timeline for d5ctjb_:

• d5ctjb_ first appeared in SCOPe 2.06
  
• d5ctjb_ appears in SCOPe 2.07