SCOPe 2.08: Domain d5cvqa_: 5cvq A:

Lineage for d5cvqa_ (5cvq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:64187] [188927] (16 PDB entries)

8. Domain d5cvqa_: 5cvq A: [320296]
   automated match to d3dlda_
   complexed with act, bb2, cd

Details for d5cvqa_

PDB Entry: 5cvq, 2.5 Å

PDB Description: structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv oryzae, in complex with actinonin

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5cvqa_:

Sequence, based on SEQRES records:

>d5cvqa_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvl

Sequence, based on observed residues (ATOM records):

>d5cvqa_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfpavpltalanaqieplsdemengwegclsipglravipryryiryrgfapdgspier
eaegfharvvqheydhlvgrlypsrienfdtfgfddvl

Timeline for d5cvqa_:

• d5cvqa_ first appeared in SCOPe 2.06
  
• d5cvqa_ appears in SCOPe 2.07