Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein automated matches [190358] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries) |
Domain d5cx3a_: 5cx3 A: [320265] automated match to d3wanb_ complexed with gol |
PDB Entry: 5cx3 (more details), 2.3 Å
SCOPe Domain Sequences for d5cx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cx3a_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdrpfkqrrsfadrckevqqirdqhpskipviierykgekqlpvldktkflvpdhvnmse lvkiirrrlqlnptqaffllvnqhsmvsvstpiadiyeqekdedgflymvyasqetfgf
Timeline for d5cx3a_: