Lineage for d1g17a_ (1g17 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582148Protein Rab-related protein Sec4 [52607] (1 species)
  7. 582149Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (2 PDB entries)
  8. 582154Domain d1g17a_: 1g17 A: [32026]

Details for d1g17a_

PDB Entry: 1g17 (more details), 2 Å

PDB Description: crystal structure of sec4-guanosine-5'-(beta,gamma)-imidotriphosphate

SCOP Domain Sequences for d1g17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g17a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

SCOP Domain Coordinates for d1g17a_:

Click to download the PDB-style file with coordinates for d1g17a_.
(The format of our PDB-style files is described here.)

Timeline for d1g17a_: