SCOP 1.71: Domain d1g17a_: 1g17 A:

Lineage for d1g17a_ (1g17 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (2 PDB entries)

8. Domain d1g17a_: 1g17 A: [32026]

Details for d1g17a_

PDB Entry: 1g17, 2 Å

PDB Description: crystal structure of sec4-guanosine-5'-(beta,gamma)-imidotriphosphate

SCOP Domain Sequences for d1g17a_:

Sequence; same for both SEQRES and ATOM records:

>d1g17a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

Timeline for d1g17a_:

• d1g17a_ first appeared (with stable ids) in SCOP 1.55
  
• d1g17a_ appears in SCOP 1.69
  
• d1g17a_ appears in SCOP 1.73
  
• d1g17a_ appears in the current release, SCOPe 2.08