Lineage for d5a5ja1 (5a5j A:26-489)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (64 PDB entries)
  8. 2331630Domain d5a5ja1: 5a5j A:26-489 [320253]
    Other proteins in same PDB: d5a5ja2
    automated match to d2vn0a_
    complexed with 6yf, hem

Details for d5a5ja1

PDB Entry: 5a5j (more details), 2.9 Å

PDB Description: cytochrome 2c9 p450 inhibitor complex
PDB Compounds: (A:) Cytochrome P450 2C9

SCOPe Domain Sequences for d5a5ja1:

Sequence, based on SEQRES records: (download)

>d5a5ja1 a.104.1.1 (A:26-489) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavke
alidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrv
qeearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneni
kilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfid
cflmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqe
eiervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgt
tilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmel
flfltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfip

Sequence, based on observed residues (ATOM records): (download)

>d5a5ja1 a.104.1.1 (A:26-489) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgklppgptplplqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkealidl
geefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqeear
clveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenikilss
pwipiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcflmkmekekhn
qpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeeiervigrnrsp
cmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgttilisltsvlhd
nkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelflfltsilqnfn
lkslvdpknldttpvvngfasvppfyqlcfip

SCOPe Domain Coordinates for d5a5ja1:

Click to download the PDB-style file with coordinates for d5a5ja1.
(The format of our PDB-style files is described here.)

Timeline for d5a5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a5ja2