SCOPe 2.05: Domain d1g16c_: 1g16 C:

Lineage for d1g16c_ (1g16 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (3 PDB entries)

8. Domain d1g16c_: 1g16 C: [32024]
   complexed with co, gdp

Details for d1g16c_

PDB Entry: 1g16, 1.8 Å

PDB Description: crystal structure of sec4-gdp

PDB Compounds: (C:) Ras-related protein SEC4

SCOPe Domain Sequences for d1g16c_:

Sequence; same for both SEQRES and ATOM records:

>d1g16c_ c.37.1.8 (C:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekid

Timeline for d1g16c_:

• d1g16c_ first appeared (with stable ids) in SCOP 1.55
  
• d1g16c_ appears in SCOPe 2.04
  
• d1g16c_ appears in SCOPe 2.06
  
• d1g16c_ appears in the current release, SCOPe 2.08