SCOP 1.71: Domain d1g16c_: 1g16 C:

Lineage for d1g16c_ (1g16 C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (2 PDB entries)

8. Domain d1g16c_: 1g16 C: [32024]

Details for d1g16c_

PDB Entry: 1g16, 1.8 Å

PDB Description: crystal structure of sec4-gdp

SCOP Domain Sequences for d1g16c_:

Sequence; same for both SEQRES and ATOM records:

>d1g16c_ c.37.1.8 (C:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekid

Timeline for d1g16c_:

• d1g16c_ first appeared (with stable ids) in SCOP 1.55
  
• d1g16c_ appears in SCOP 1.69
  
• d1g16c_ appears in SCOP 1.73
  
• d1g16c_ appears in the current release, SCOPe 2.08