Lineage for d5lc1d1 (5lc1 D:3-321)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849133Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (22 PDB entries)
  8. 2849201Domain d5lc1d1: 5lc1 D:3-321 [320224]
    Other proteins in same PDB: d5lc1a2, d5lc1b2, d5lc1c2, d5lc1d2, d5lc1e2, d5lc1f2
    automated match to d4yraa_
    complexed with act, bme, na, nad, pyr

Details for d5lc1d1

PDB Entry: 5lc1 (more details), 2.1 Å

PDB Description: l-threonine dehydrogenase from trypanosoma brucei with nad and the inhibitor pyruvate bound.
PDB Compounds: (D:) L-threonine 3-dehydrogenase

SCOPe Domain Sequences for d5lc1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lc1d1 c.2.1.0 (D:3-321) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
mmsedmlrqipilhglpsl

SCOPe Domain Coordinates for d5lc1d1:

Click to download the PDB-style file with coordinates for d5lc1d1.
(The format of our PDB-style files is described here.)

Timeline for d5lc1d1: