Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d4zole_: 4zol E: [320221] Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolb2, d4zolc1, d4zolc2, d4zold1, d4zold2, d4zolf1, d4zolf2, d4zolf3 automated match to d4i55e_ complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zol (more details), 2.5 Å
SCOPe Domain Sequences for d4zole_:
Sequence, based on SEQRES records: (download)
>d4zole_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d4zole_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsrdpsleeiqkkleaaeerrkyqeaellkhlaekrehe reviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkel ke
Timeline for d4zole_: