Lineage for d5kc5a1 (5kc5 A:58-193)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2049110Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2049111Protein automated matches [190873] (4 species)
    not a true protein
  7. 2049112Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2049154Domain d5kc5a1: 5kc5 A:58-193 [320203]
    Other proteins in same PDB: d5kc5a2
    automated match to d2wnvb_
    complexed with nag

Details for d5kc5a1

PDB Entry: 5kc5 (more details), 2.35 Å

PDB Description: crystal structure of the cbln1 c1q domain trimer
PDB Compounds: (A:) Cerebellin-1

SCOPe Domain Sequences for d5kc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kc5a1 b.22.1.0 (A:58-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfh
vvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlm
ggwkystfsgflvfpl

SCOPe Domain Coordinates for d5kc5a1:

Click to download the PDB-style file with coordinates for d5kc5a1.
(The format of our PDB-style files is described here.)

Timeline for d5kc5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kc5a2