SCOPe 2.08: Domain d5kc5a1: 5kc5 A:58-193

Lineage for d5kc5a1 (5kc5 A:58-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d5kc5a1: 5kc5 A:58-193 [320203]
   Other proteins in same PDB: d5kc5a2
   automated match to d2wnvb_
   complexed with nag

Details for d5kc5a1

PDB Entry: 5kc5, 2.35 Å

PDB Description: crystal structure of the cbln1 c1q domain trimer

PDB Compounds: (A:) Cerebellin-1

SCOPe Domain Sequences for d5kc5a1:

Sequence; same for both SEQRES and ATOM records:

>d5kc5a1 b.22.1.0 (A:58-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfh
vvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlm
ggwkystfsgflvfpl

Timeline for d5kc5a1:

• d5kc5a1 first appeared in SCOPe 2.06
  
• d5kc5a1 appears in SCOPe 2.07