Lineage for d1huqa_ (1huq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363436Protein Rab5c [52603] (1 species)
  7. 1363437Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries)
  8. 1363439Domain d1huqa_: 1huq A: [32020]
    complexed with gnp, mg

Details for d1huqa_

PDB Entry: 1huq (more details), 1.8 Å

PDB Description: 1.8a crystal structure of the monomeric gtpase rab5c (mouse)
PDB Compounds: (A:) rab5c

SCOPe Domain Sequences for d1huqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huqa_ c.37.1.8 (A:) Rab5c {Mouse (Mus musculus) [TaxId: 10090]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl

SCOPe Domain Coordinates for d1huqa_:

Click to download the PDB-style file with coordinates for d1huqa_.
(The format of our PDB-style files is described here.)

Timeline for d1huqa_: