Lineage for d1huqa_ (1huq A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23260Protein Rab5c [52603] (1 species)
  7. 23261Species Mouse (Mus musculus) [TaxId:10090] [52604] (1 PDB entry)
  8. 23262Domain d1huqa_: 1huq A: [32020]

Details for d1huqa_

PDB Entry: 1huq (more details), 1.8 Å

PDB Description: 1.8a crystal structure of the monomeric gtpase rab5c (mouse)

SCOP Domain Sequences for d1huqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huqa_ c.37.1.8 (A:) Rab5c {Mouse (Mus musculus)}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl

SCOP Domain Coordinates for d1huqa_:

Click to download the PDB-style file with coordinates for d1huqa_.
(The format of our PDB-style files is described here.)

Timeline for d1huqa_: