Lineage for d5fuxb1 (5fux B:204-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873129Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319946] (4 PDB entries)
  8. 2873133Domain d5fuxb1: 5fux B:204-338 [320197]
    Other proteins in same PDB: d5fuxa2, d5fuxb2
    automated match to d1xbta1
    complexed with mg, po4, qbt, zn

Details for d5fuxb1

PDB Entry: 5fux (more details), 2.2 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
PDB Compounds: (B:) thymdine kinase

SCOPe Domain Sequences for d5fuxb1:

Sequence, based on SEQRES records: (download)

>d5fuxb1 c.37.1.0 (B:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtrysegaitshdqraltan
vsvsnlhdvgdewrkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfee
icllvsradsvvkls

Sequence, based on observed residues (ATOM records): (download)

>d5fuxb1 c.37.1.0 (B:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgltanvsvsnlhdvgdewrky
dviavdegqffpdvaafcskaadsgkvvivsaldadylqepfeeicllvsradsvvkls

SCOPe Domain Coordinates for d5fuxb1:

Click to download the PDB-style file with coordinates for d5fuxb1.
(The format of our PDB-style files is described here.)

Timeline for d5fuxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fuxb2