SCOPe 2.08: Domain d4zolb1: 4zol B:1-245

Lineage for d4zolb1 (4zol B:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52497] (9 PDB entries)

8. Domain d4zolb1: 4zol B:1-245 [320195]
   Other proteins in same PDB: d4zola1, d4zola2, d4zolb2, d4zolc1, d4zolc2, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3
   automated match to d1sa0b1
   complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolb1

PDB Entry: 4zol, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zolb1:

Sequence; same for both SEQRES and ATOM records:

>d4zolb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d4zolb1:

• d4zolb1 first appeared in SCOPe 2.06
  
• d4zolb1 appears in SCOPe 2.07