Lineage for d1zbda_ (1zbd A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363404Protein Rab3a [52601] (1 species)
  7. 1363405Species Norway rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries)
  8. 1363407Domain d1zbda_: 1zbd A: [32019]
    Other proteins in same PDB: d1zbdb_
    complexed with gtp, mg, zn

Details for d1zbda_

PDB Entry: 1zbd (more details), 2.6 Å

PDB Description: structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d1zbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbda_ c.37.1.8 (A:) Rab3a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shmfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqi
wdtagleryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgn
kcdmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicekmsesld

SCOPe Domain Coordinates for d1zbda_:

Click to download the PDB-style file with coordinates for d1zbda_.
(The format of our PDB-style files is described here.)

Timeline for d1zbda_: