Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein automated matches [190294] (6 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [320186] (1 PDB entry) |
Domain d4zzlb_: 4zzl B: [320187] Other proteins in same PDB: d4zzla2 automated match to d1lnwa_ complexed with gol; mutant |
PDB Entry: 4zzl (more details), 2.19 Å
SCOPe Domain Sequences for d4zzlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zzlb_ a.4.5.28 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} vnpdlmpalmavfqhvwtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcrd kalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfaplt pveqatlvhlldqcl
Timeline for d4zzlb_: