SCOPe 2.06: Domain d5fuyb2: 5fuy B:339-383

Lineage for d5fuyb2 (5fuy B:339-383)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (7 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5691] [319948] (4 PDB entries)

8. Domain d5fuyb2: 5fuy B:339-383 [320178]
   Other proteins in same PDB: d5fuya1, d5fuyb1, d5fuyc1, d5fuyd1, d5fuye1, d5fuye3, d5fuyf1
   automated match to d1xbta2
   complexed with po4, qbt, zn

Details for d5fuyb2

PDB Entry: 5fuy, 2.8 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp

PDB Compounds: (B:) thymdine kinase

SCOPe Domain Sequences for d5fuyb2:

Sequence; same for both SEQRES and ATOM records:

>d5fuyb2 g.39.1.0 (B:339-383) automated matches {Trypanosoma brucei [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrn

Timeline for d5fuyb2:

• d5fuyb2 is new in SCOPe 2.06-stable
  
• d5fuyb2 appears in SCOPe 2.07
  
• d5fuyb2 appears in the current release, SCOPe 2.08