SCOPe 2.05: Domain d3raps_: 3rap S:

Lineage for d3raps_ (3rap S:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rap2a [52599] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)

8. Domain d3raps_: 3rap S: [32016]
   complexed with gtp, mg

Details for d3raps_

PDB Entry: 3rap, 2.2 Å

PDB Description: the small g protein rap2 in a non catalytic complex with gtp

PDB Compounds: (S:) PROTEIN (G protein RAP2A)

SCOPe Domain Sequences for d3raps_:

Sequence; same for both SEQRES and ATOM records:

>d3raps_ c.37.1.8 (S:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

Timeline for d3raps_:

• d3raps_ first appeared (with stable ids) in SCOP 1.55
  
• d3raps_ appears in SCOPe 2.04
  
• d3raps_ appears in SCOPe 2.06
  
• d3raps_ appears in the current release, SCOPe 2.08