Lineage for d3raps_ (3rap S:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23302Protein Rap2a [52599] (1 species)
  7. 23303Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)
  8. 23306Domain d3raps_: 3rap S: [32016]

Details for d3raps_

PDB Entry: 3rap (more details), 2.2 Å

PDB Description: the small g protein rap2 in a non catalytic complex with gtp

SCOP Domain Sequences for d3raps_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3raps_ c.37.1.8 (S:) Rap2a {Human (Homo sapiens)}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

SCOP Domain Coordinates for d3raps_:

Click to download the PDB-style file with coordinates for d3raps_.
(The format of our PDB-style files is described here.)

Timeline for d3raps_: