Lineage for d5jp1b1 (5jp1 B:19-95)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178992Species Solanum lycopersicum [TaxId:4081] [320155] (1 PDB entry)
  8. 2178993Domain d5jp1b1: 5jp1 B:19-95 [320156]
    Other proteins in same PDB: d5jp1b2
    automated match to d1a5ra_
    complexed with d1d, mli

Details for d5jp1b1

PDB Entry: 5jp1 (more details), 2.1 Å

PDB Description: structure of xanthomonas campestris effector protein xopd bound to tomato sumo
PDB Compounds: (B:) Small ubiquitin-related modifier

SCOPe Domain Sequences for d5jp1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jp1b1 d.15.1.0 (B:19-95) automated matches {Solanum lycopersicum [TaxId: 4081]}
vhinlkvkgqdgnevffrikrstqmrklmnaycdrqsvdmnsiaflfdgrrlraeqtpde
lemeegdeidamlhqtg

SCOPe Domain Coordinates for d5jp1b1:

Click to download the PDB-style file with coordinates for d5jp1b1.
(The format of our PDB-style files is described here.)

Timeline for d5jp1b1: