SCOPe 2.08: Domain d5jp1b1: 5jp1 B:19-95

Lineage for d5jp1b1 (5jp1 B:19-95)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Solanum lycopersicum [TaxId:4081] [320155] (1 PDB entry)

8. Domain d5jp1b1: 5jp1 B:19-95 [320156]
   Other proteins in same PDB: d5jp1b2
   automated match to d1a5ra_
   complexed with d1d, mli

Details for d5jp1b1

PDB Entry: 5jp1, 2.1 Å

PDB Description: structure of xanthomonas campestris effector protein xopd bound to tomato sumo

PDB Compounds: (B:) Small ubiquitin-related modifier

SCOPe Domain Sequences for d5jp1b1:

Sequence; same for both SEQRES and ATOM records:

>d5jp1b1 d.15.1.0 (B:19-95) automated matches {Solanum lycopersicum [TaxId: 4081]}
vhinlkvkgqdgnevffrikrstqmrklmnaycdrqsvdmnsiaflfdgrrlraeqtpde
lemeegdeidamlhqtg

Timeline for d5jp1b1:

• d5jp1b1 first appeared in SCOPe 2.06
  
• d5jp1b1 appears in SCOPe 2.07