Lineage for d3rapr_ (3rap R:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125048Protein Rap2a [52599] (1 species)
  7. 2125049Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)
  8. 2125051Domain d3rapr_: 3rap R: [32015]
    complexed with gtp, mg

Details for d3rapr_

PDB Entry: 3rap (more details), 2.2 Å

PDB Description: the small g protein rap2 in a non catalytic complex with gtp
PDB Compounds: (R:) PROTEIN (G protein RAP2A)

SCOPe Domain Sequences for d3rapr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rapr_ c.37.1.8 (R:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

SCOPe Domain Coordinates for d3rapr_:

Click to download the PDB-style file with coordinates for d3rapr_.
(The format of our PDB-style files is described here.)

Timeline for d3rapr_: