Lineage for d5ktta_ (5ktt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923617Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2923618Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2923619Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2923620Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2923623Species Pyrococcus horikoshii [TaxId:70601] [319156] (12 PDB entries)
  8. 2923629Domain d5ktta_: 5ktt A: [320144]
    automated match to d1wzua1
    complexed with lmr, sf4

Details for d5ktta_

PDB Entry: 5ktt (more details), 1.5 Å

PDB Description: crystal structure of pyrococcus horikoshii quinolinate synthase (nada) with bound l-malate and fe4s4 cluster
PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d5ktta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktta_ c.145.1.1 (A:) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
erakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrkl
ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems

SCOPe Domain Coordinates for d5ktta_:

Click to download the PDB-style file with coordinates for d5ktta_.
(The format of our PDB-style files is described here.)

Timeline for d5ktta_: