![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Diaphorobacter sp. [TaxId:1302548] [319967] (2 PDB entries) |
![]() | Domain d5brci_: 5brc I: [320141] Other proteins in same PDB: d5brca1, d5brca2, d5brcd1, d5brcd2, d5brcg1, d5brcg2 automated match to d2bmob1 complexed with fe, fes |
PDB Entry: 5brc (more details), 2.9 Å
SCOPe Domain Sequences for d5brci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5brci_ d.17.4.4 (I:) automated matches {Diaphorobacter sp. [TaxId: 1302548]} mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp erilphnllvfl
Timeline for d5brci_: