SCOPe 2.06: Domain d5k9jl2: 5k9j L:107-211

Lineage for d5k9jl2 (5k9j L:107-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5k9jl2: 5k9j L:107-211 [320131]
   Other proteins in same PDB: d5k9jl1
   automated match to d1dn0a2
   complexed with 15p

Details for d5k9jl2

PDB Entry: 5k9j, 1.9 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 isolated following h5 immunization.

PDB Compounds: (L:) 56.a.09 light chain

SCOPe Domain Sequences for d5k9jl2:

Sequence; same for both SEQRES and ATOM records:

>d5k9jl2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5k9jl2:

• d5k9jl2 is new in SCOPe 2.06-stable
  
• d5k9jl2 appears in SCOPe 2.07
  
• d5k9jl2 appears in the current release, SCOPe 2.08