Lineage for d5j5vd_ (5j5v D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 2480966Species Escherichia coli [TaxId:83334] [320059] (2 PDB entries)
  8. 2480970Domain d5j5vd_: 5j5v D: [320085]
    automated match to d1d6sa_

Details for d5j5vd_

PDB Entry: 5j5v (more details), 2.75 Å

PDB Description: cdia-ct from uropathogenic escherichia coli in complex with cognate immunity protein and cysk
PDB Compounds: (D:) Cysteine synthase A

SCOPe Domain Sequences for d5j5vd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j5vd_ c.79.1.1 (D:) automated matches {Escherichia coli [TaxId: 83334]}
gkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtggt
ltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanldl
klvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfad

SCOPe Domain Coordinates for d5j5vd_:

Click to download the PDB-style file with coordinates for d5j5vd_.
(The format of our PDB-style files is described here.)

Timeline for d5j5vd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j5va_