SCOPe 2.08: Domain d5fuvb2: 5fuv B:339-383

Lineage for d5fuvb2 (5fuv B:339-383)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries)

8. Domain d5fuvb2: 5fuv B:339-383 [320080]
   Other proteins in same PDB: d5fuva1, d5fuvb1
   automated match to d1xbta2
   complexed with gol, po4, thm, zn

Details for d5fuvb2

PDB Entry: 5fuv, 2.3 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dthd

PDB Compounds: (B:) thymdine kinase

SCOPe Domain Sequences for d5fuvb2:

Sequence; same for both SEQRES and ATOM records:

>d5fuvb2 g.39.1.0 (B:339-383) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrn

Timeline for d5fuvb2:

• d5fuvb2 first appeared in SCOPe 2.06
  
• d5fuvb2 appears in SCOPe 2.07