Lineage for d1e96a_ (1e96 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23266Protein Rac [52595] (1 species)
  7. 23267Species Human (Homo sapiens) [TaxId:9606] [52596] (6 PDB entries)
  8. 23273Domain d1e96a_: 1e96 A: [32007]
    Other proteins in same PDB: d1e96b_

Details for d1e96a_

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex

SCOP Domain Sequences for d1e96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96a_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

SCOP Domain Coordinates for d1e96a_:

Click to download the PDB-style file with coordinates for d1e96a_.
(The format of our PDB-style files is described here.)

Timeline for d1e96a_: