SCOPe 2.06: Domain d5c6fi1: 5c6f I:1-166

Lineage for d5c6fi1 (5c6f I:1-166)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [188967] (2 PDB entries)

8. Domain d5c6fi1: 5c6f I:1-166 [320063]
   Other proteins in same PDB: d5c6fa2, d5c6fb2, d5c6fc2, d5c6fd2, d5c6fe2, d5c6ff2, d5c6fg2, d5c6fh2, d5c6fi2, d5c6fj2, d5c6fk2, d5c6fl2
   automated match to d1krqa_
   complexed with fe, imd; mutant

Details for d5c6fi1

PDB Entry: 5c6f, 2 Å

PDB Description: crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen

PDB Compounds: (I:) Bacterial non-heme ferritin

SCOPe Domain Sequences for d5c6fi1:

Sequence; same for both SEQRES and ATOM records:

>d5c6fi1 a.25.1.1 (I:1-166) automated matches {Helicobacter pylori [TaxId: 85963]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d5c6fi1:

• d5c6fi1 is new in SCOPe 2.06-stable
  
• d5c6fi1 appears in SCOPe 2.07
  
• d5c6fi1 appears in the current release, SCOPe 2.08