Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (10 species) |
Species Saccharomyces bayanus [TaxId:4931] [320047] (1 PDB entry) |
Domain d5i9eb1: 5i9e B:5-146 [320048] automated match to d1yaga1 complexed with atp, mg |
PDB Entry: 5i9e (more details), 2.8 Å
SCOPe Domain Sequences for d5i9eb1:
Sequence, based on SEQRES records: (download)
>d5i9eb1 c.55.1.1 (B:5-146) Actin {Saccharomyces bayanus [TaxId: 4931]} vaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrgi ltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimf etfnvpafyvsiqavlslyssg
>d5i9eb1 c.55.1.1 (B:5-146) Actin {Saccharomyces bayanus [TaxId: 4931]} vaalvidngsgmckagfagddapravfpsivgrsyvgdeaqskrgiltlrypiehgivtn wddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfnvpafyvsiqa vlslyssg
Timeline for d5i9eb1: