SCOPe 2.08: Domain d5i9eb1: 5i9e B:5-146

Lineage for d5i9eb1 (5i9e B:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Saccharomyces bayanus [TaxId:4931] [320047] (1 PDB entry)

8. Domain d5i9eb1: 5i9e B:5-146 [320048]
   automated match to d1yaga1
   complexed with atp, mg

Details for d5i9eb1

PDB Entry: 5i9e, 2.8 Å

PDB Description: crystal structure of a nuclear actin ternary complex

PDB Compounds: (B:) actin

SCOPe Domain Sequences for d5i9eb1:

Sequence, based on SEQRES records:

>d5i9eb1 c.55.1.1 (B:5-146) Actin {Saccharomyces bayanus [TaxId: 4931]}
vaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrgi
ltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimf
etfnvpafyvsiqavlslyssg

Sequence, based on observed residues (ATOM records):

>d5i9eb1 c.55.1.1 (B:5-146) Actin {Saccharomyces bayanus [TaxId: 4931]}
vaalvidngsgmckagfagddapravfpsivgrsyvgdeaqskrgiltlrypiehgivtn
wddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfnvpafyvsiqa
vlslyssg

Timeline for d5i9eb1:

• d5i9eb1 first appeared in SCOPe 2.06
  
• d5i9eb1 appears in SCOPe 2.07