Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rac [52595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries) |
Domain d1he1c1: 1he1 C:2-176 [32003] Other proteins in same PDB: d1he1a1, d1he1a2, d1he1b1, d1he1b2, d1he1c2, d1he1d2 rac1 in complex with the GAP domain of ExoS complexed with af3, gdp, mg, ni |
PDB Entry: 1he1 (more details), 2 Å
SCOPe Domain Sequences for d1he1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he1c1 c.37.1.8 (C:2-176) Rac {Human (Homo sapiens) [TaxId: 9606]} qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
Timeline for d1he1c1: