Lineage for d5brcc_ (5brc C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181740Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2181796Protein automated matches [190223] (5 species)
    not a true protein
  7. 2181880Species Diaphorobacter sp. [TaxId:1302548] [319967] (2 PDB entries)
  8. 2181884Domain d5brcc_: 5brc C: [319986]
    Other proteins in same PDB: d5brca1, d5brca2, d5brcd1, d5brcd2, d5brcg1, d5brcg2
    automated match to d2bmob1
    complexed with fe, fes

Details for d5brcc_

PDB Entry: 5brc (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (C:) 3NT oxygenase beta subunit

SCOPe Domain Sequences for d5brcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brcc_ d.17.4.4 (C:) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
erilphnllvfl

SCOPe Domain Coordinates for d5brcc_:

Click to download the PDB-style file with coordinates for d5brcc_.
(The format of our PDB-style files is described here.)

Timeline for d5brcc_:

  • d5brcc_ is new in SCOPe 2.06-stable
  • d5brcc_ does not appear in SCOPe 2.07