SCOPe 2.07: Domain d5g09b_: 5g09 B:

Lineage for d5g09b_ (5g09 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [319950] (2 PDB entries)

8. Domain d5g09b_: 5g09 B: [319980]
   Other proteins in same PDB: d5g09a2, d5g09c2
   automated match to d4e3rc_
   complexed with 1pe, 6df, peg, pg4, pge

Details for d5g09b_

PDB Entry: 5g09, 1.9 Å

PDB Description: the crystal structure of a s-selective transaminase from bacillus megaterium bound with r-alpha-methylbenzylamine

PDB Compounds: (B:) Transaminase

SCOPe Domain Sequences for d5g09b_:

Sequence; same for both SEQRES and ATOM records:

>d5g09b_ c.67.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
ltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycv
nlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgs
eavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipg
ssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqga
gsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglss
sslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsge
yirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqii
mkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgew

Timeline for d5g09b_:

• d5g09b_ first appeared in SCOPe 2.06
  
• d5g09b_ appears in the current release, SCOPe 2.08