SCOPe 2.08: Domain d5fuxa1: 5fux A:203-338

Lineage for d5fuxa1 (5fux A:203-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319946] (4 PDB entries)

8. Domain d5fuxa1: 5fux A:203-338 [319956]
   Other proteins in same PDB: d5fuxa2, d5fuxb2
   automated match to d1xbta1
   complexed with mg, po4, qbt, zn

Details for d5fuxa1

PDB Entry: 5fux, 2.2 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp

PDB Compounds: (A:) thymdine kinase

SCOPe Domain Sequences for d5fuxa1:

Sequence, based on SEQRES records:

>d5fuxa1 c.37.1.0 (A:203-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ahgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtrysegaitshdqralta
nvsvsnlhdvgdewrkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfe
eicllvsradsvvkls

Sequence, based on observed residues (ATOM records):

>d5fuxa1 c.37.1.0 (A:203-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ahgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtltanvsvsnlhdvgdew
rkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfeeicllvsradsvvk
ls

Timeline for d5fuxa1:

• d5fuxa1 first appeared in SCOPe 2.06
  
• d5fuxa1 appears in SCOPe 2.07