Lineage for d5g09c1 (5g09 C:7-474)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148520Species Bacillus megaterium [TaxId:1404] [319950] (2 PDB entries)
  8. 2148525Domain d5g09c1: 5g09 C:7-474 [319951]
    Other proteins in same PDB: d5g09a2, d5g09c2
    automated match to d4e3rc_
    complexed with 1pe, 6df, peg, pg4, pge

Details for d5g09c1

PDB Entry: 5g09 (more details), 1.9 Å

PDB Description: the crystal structure of a s-selective transaminase from bacillus megaterium bound with r-alpha-methylbenzylamine
PDB Compounds: (C:) Transaminase

SCOPe Domain Sequences for d5g09c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g09c1 c.67.1.0 (C:7-474) automated matches {Bacillus megaterium [TaxId: 1404]}
kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgq
knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
talniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssyn
savlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqgagsam
ppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglsssslp
agavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsgeyirs
klellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqiimkka
lekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq

SCOPe Domain Coordinates for d5g09c1:

Click to download the PDB-style file with coordinates for d5g09c1.
(The format of our PDB-style files is described here.)

Timeline for d5g09c1: