SCOP 1.71: Domain d1he8b_: 1he8 B:

Lineage for d1he8b_ (1he8 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (47 PDB entries)

8. Domain d1he8b_: 1he8 B: [31995]
   Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4
   complexed with gnp, mg; mutant

Details for d1he8b_

PDB Entry: 1he8, 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex

SCOP Domain Sequences for d1he8b_:

Sequence; same for both SEQRES and ATOM records:

>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1he8b_:

• d1he8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1he8b_ appears in SCOP 1.69
  
• d1he8b_ appears in SCOP 1.73
  
• d1he8b_ appears in the current release, SCOPe 2.08