Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein cH-p21 Ras protein [52593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52594] (47 PDB entries) |
Domain d1he8b_: 1he8 B: [31995] Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4 complexed with gnp, mg; mutant |
PDB Entry: 1he8 (more details), 3 Å
SCOP Domain Sequences for d1he8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)} mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d1he8b_:
View in 3D Domains from other chains: (mouse over for more information) d1he8a1, d1he8a2, d1he8a3, d1he8a4 |