SCOPe 2.08: Domain d1plja_: 1plj A:

Lineage for d1plja_ (1plj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
   Uniprot Q6P716

8. Domain d1plja_: 1plj A: [31994]
   complexed with cag, mg

Details for d1plja_

PDB Entry: 1plj, 2.8 Å

PDB Description: crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points

PDB Compounds: (A:) c-h-ras p21 protein

SCOPe Domain Sequences for d1plja_:

Sequence, based on SEQRES records:

>d1plja_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d1plja_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvidgetclldidtagsa
mdqymtggflcfainntsedihqyreqikrvkdsddvpmvlvgnkcdlaarvesrqaqdl
arsygipyietsaktrqgvedafytlvreiqh

Timeline for d1plja_:

• d1plja_ first appeared (with stable ids) in SCOP 1.55, called d1plj__
  
• d1plja_ appears in SCOPe 2.07