SCOPe 2.08: Domain d5b0wb_: 5b0w B:

Lineage for d5b0wb_ (5b0w B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Natronomonas pharaonis [TaxId:348780] [255740] (4 PDB entries)

8. Domain d5b0wb_: 5b0w B: [319921]
   automated match to d3qbga_
   complexed with 22b, bng, ile, l3p, ret

Details for d5b0wb_

PDB Entry: 5b0w, 1.7 Å

PDB Description: crystal structure of the 11-cis isomer of pharaonis halorhodopsin in the absence of halide ions

PDB Compounds: (B:) halorhodopsin

SCOPe Domain Sequences for d5b0wb_:

Sequence; same for both SEQRES and ATOM records:

>d5b0wb_ f.13.1.0 (B:) automated matches {Natronomonas pharaonis [TaxId: 348780]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsgs

Timeline for d5b0wb_:

• d5b0wb_ first appeared in SCOPe 2.06
  
• d5b0wb_ appears in SCOPe 2.07