SCOPe 2.08: Domain d4z9ia_: 4z9i A:

Lineage for d4z9ia_ (4z9i A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families)
   automatically mapped to Pfam PF02203

5. Family a.24.2.0: automated matches [254222] (1 protein)
   not a true family

6. Protein automated matches [254505] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [319821] (3 PDB entries)

8. Domain d4z9ia_: 4z9i A: [319875]
   automated match to d2d4ub_
   complexed with asp

Details for d4z9ia_

PDB Entry: 4z9i, 1.57 Å

PDB Description: asp-tars from e. coli

PDB Compounds: (A:) methyl-accepting chemotaxis protein II

SCOPe Domain Sequences for d4z9ia_:

Sequence; same for both SEQRES and ATOM records:

>d4z9ia_ a.24.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
lffsslhhsqksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnakv
elldsarktlaqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygntg
ayfaqptqgmqnamgeafaqyalsseklyrdivtdnaddyrfaq

Timeline for d4z9ia_:

• d4z9ia_ first appeared in SCOPe 2.06
  
• d4z9ia_ appears in SCOPe 2.07