Lineage for d5la6c2 (5la6 C:254-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959482Domain d5la6c2: 5la6 C:254-440 [319838]
    Other proteins in same PDB: d5la6a1, d5la6b1, d5la6c1, d5la6d1, d5la6e_, d5la6f1, d5la6f2, d5la6f3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mg, x3h

Details for d5la6c2

PDB Entry: 5la6 (more details), 2.1 Å

PDB Description: tubulin-pironetin complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5la6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5la6c2 d.79.2.1 (C:254-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
efqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkym
accllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdlakvqr
avcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdye
evgvdsv

SCOPe Domain Coordinates for d5la6c2:

Click to download the PDB-style file with coordinates for d5la6c2.
(The format of our PDB-style files is described here.)

Timeline for d5la6c2: