Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (9 species) not a true protein |
Species Lachancea thermotolerans [TaxId:381046] [319809] (1 PDB entry) |
Domain d5lhoa_: 5lho A: [319810] automated match to d4dnkb_ |
PDB Entry: 5lho (more details), 1.95 Å
SCOPe Domain Sequences for d5lhoa_:
Sequence, based on SEQRES records: (download)
>d5lhoa_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 381046]} sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri vssieqkeeakdksehqvklirdyrskieteltkicddilsvldthlipsattgeskvfy ykmkgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfy yeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwts
>d5lhoa_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 381046]} sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri vssieqkeeakehqvklirdyrskieteltkicddilsvldthlipsattgeskvfyykm kgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfyyei qnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d5lhoa_: