Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries) |
Domain d5cmma1: 5cmm A:2-259 [319789] Other proteins in same PDB: d5cmma2 automated match to d3g3ja_ complexed with sym |
PDB Entry: 5cmm (more details), 1.27 Å
SCOPe Domain Sequences for d5cmma1:
Sequence, based on SEQRES records: (download)
>d5cmma1 c.94.1.0 (A:2-259) automated matches {Human (Homo sapiens) [TaxId: 9606]} snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky gaqddvngqwngmvrelidhkadlavapltityvrekvidfskpfmtlgisilyrkgtpi dsaddlakqtkieygavedgstmtffkkskistydkmwafmssrrqsvlvksseegiqrv ltsdyallmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee gklhmmkekwwrgngcpe
>d5cmma1 c.94.1.0 (A:2-259) automated matches {Human (Homo sapiens) [TaxId: 9606]} snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky gaqddvngqwngmvrelidhkadlavapltityvrekvidfskpfmtlgisilyrkgtpi dsaddlakqtkieygavedgstmtffkkskistydkmwafmssrrqsvlvksseegiqrv ltsdyallmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee gklhmmkekwwrgcpe
Timeline for d5cmma1: