SCOPe 2.08: Domain d5k93b1: 5k93 B:1-124

Lineage for d5k93b1 (5k93 B:1-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)

8. Domain d5k93b1: 5k93 B:1-124 [319787]
   Other proteins in same PDB: d5k93a2, d5k93b2
   automated match to d2j7la1

Details for d5k93b1

PDB Entry: 5k93, 2.7 Å

PDB Description: papd wild-type chaperone

PDB Compounds: (B:) chaperone protein papd

SCOPe Domain Sequences for d5k93b1:

Sequence, based on SEQRES records:

>d5k93b1 b.1.11.1 (B:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Sequence, based on observed residues (ATOM records):

>d5k93b1 b.1.11.1 (B:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprseialqtkiklfyrpaaiktrp

Timeline for d5k93b1:

• d5k93b1 first appeared in SCOPe 2.06
  
• d5k93b1 appears in SCOPe 2.07